FAM98B Antibody - N-terminal region : FITC

FAM98B Antibody - N-terminal region : FITC
SKU
AVIARP55664_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of FAM98B is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM98B

Key Reference: Tsuritani,K., (2007) Genome Res. 17 (7), 1005-1014

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM98B Ensembl ENSP00000380734

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP55664_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55664_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283742
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×