FBXO10 Antibody - C-terminal region : Biotin

FBXO10 Antibody - C-terminal region : Biotin
SKU
AVIARP54858_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBX10

Key Reference: N/A

Molecular Weight: 105kDa

Peptide Sequence: Synthetic peptide located within the following region: SDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box only protein 10

Protein Size: 956

Purification: Affinity purified
More Information
SKU AVIARP54858_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54858_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26267
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×