FDXR Antibody - middle region : Biotin

FDXR Antibody - middle region : Biotin
SKU
AVIARP54707_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FDXR

Key Reference: Trapasso,F., (2008) J. Biol. Chem. 283 (20), 13736-13744

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial

Protein Size: 491

Purification: Affinity Purified
More Information
SKU AVIARP54707_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54707_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2232
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×