FDXR Antibody - N-terminal region : HRP

FDXR Antibody - N-terminal region : HRP
SKU
AVIARP54706_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: DHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial

Protein Size: 491

Purification: Affinity Purified
More Information
SKU AVIARP54706_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54706_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2232
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×