FEM1B Antibody - middle region : Biotin

FEM1B Antibody - middle region : Biotin
SKU
AVIARP53702_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FEM1B

Key Reference: Kamura,T., (2004) Genes Dev. 18 (24), 3055-3065

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein fem-1 homolog B

Protein Size: 627

Purification: Affinity Purified
More Information
SKU AVIARP53702_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53702_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10116
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×