Fem1c Antibody - C-terminal region : HRP

Fem1c Antibody - C-terminal region : HRP
SKU
AVIARP57364_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fem1c

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fem-1 homolog c (C.elegans) (Predicted) EMBL EDM14387.1

Protein Size: 617

Purification: Affinity Purified
More Information
SKU AVIARP57364_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57364_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 302288
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×