FGF13 Antibody - middle region : HRP

FGF13 Antibody - middle region : HRP
SKU
AVIARP55412_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FGF13 is probably involved in nervous system development and function.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located to a region associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a syndromal X-linked mental retardation, which suggests it may be a candidate gene for familial cases of the BFL syndrome. The function of this gene has not yet been determined. Two alternatively spliced transcripts encoding different isoforms have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGF13

Key Reference: Popovici,C., (2004) J. Biol. Chem. 279 (38), 40146-40152

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fibroblast growth factor 13

Protein Size: 245

Purification: Affinity Purified
More Information
SKU AVIARP55412_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55412_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2258
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×