FLJ30934 Antibody - middle region : Biotin

FLJ30934 Antibody - middle region : Biotin
SKU
AVIARP55532_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ30934

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-32

Protein Size: 403

Purification: Affinity Purified
More Information
SKU AVIARP55532_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55532_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 254122
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×