Fn3k Antibody - N-terminal region : Biotin

Fn3k Antibody - N-terminal region : Biotin
SKU
AVIARP57619_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fn3k

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 203

Purification: Affinity Purified
More Information
SKU AVIARP57619_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57619_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 498034
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×