GABARAPL1 Antibody - N-terminal region : HRP

GABARAPL1 Antibody - N-terminal region : HRP
SKU
AVIARP55398_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAPL1

Key Reference: Tanida,I., (2006) FEBS J. 273 (11), 2553-2562

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1

Protein Size: 117

Purification: Affinity Purified
More Information
SKU AVIARP55398_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55398_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 23710
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×