GADL1 Antibody - middle region : FITC

GADL1 Antibody - middle region : FITC
SKU
AVIARP56000_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GADL1

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutamate decarboxylase-like protein 1

Protein Size: 521

Purification: Affinity Purified
More Information
SKU AVIARP56000_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56000_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 339896
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×