GALE Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GALE

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UDP-glucose 4-epimerase

Protein Size: 348

Purification: Affinity Purified

• SKU: AVIARP54394_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54394_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2582
• Host: Rabbit
• Conjugate: Conjugated, Biotin