GAS2L3 Antibody - N-terminal region : Biotin

GAS2L3 Antibody - N-terminal region : Biotin
SKU
AVIARP55729_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human GAS2L3

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GAS2-like protein 3

Protein Size: 590

Purification: Affinity Purified
More Information
SKU AVIARP55729_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55729_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283431
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×