GATSL3 antibody

Calculated MW: 36

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: Q8WTX7

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the C-terminal region of Human GATSL3 protein: EPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGG

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: cytosolic arginine sensor for mTORC1 subunit 1

• SKU: GTX04957-100
• Manufacturer: GeneTex
• Manufacturer SKU: GTX04957-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 652968
• Host: Rabbit
• Conjugate: Unconjugated