GEMIN4 Antibody - N-terminal region : Biotin

GEMIN4 Antibody - N-terminal region : Biotin
SKU
AVIARP56757_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes requi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GEMIN4

Key Reference: Shpargel,K.B. (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (48), 17372-17377

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gem (Nuclear organelle) associated protein 4 EMBL AAH20062.1

Protein Size: 1058

Purification: Affinity Purified
More Information
SKU AVIARP56757_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56757_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50628
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×