Gfap Antibody - N-terminal region : HRP

Gfap Antibody - N-terminal region : HRP
SKU
AVIARP54621_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glial fibrillary acidic protein

Protein Size: 418

Purification: Affinity Purified
More Information
SKU AVIARP54621_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54621_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 14580
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×