GK2 Antibody - N-terminal region : HRP

GK2 Antibody - N-terminal region : HRP
SKU
AVIARP53814_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GK2

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: DKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glycerol kinase 2

Protein Size: 553

Purification: Affinity Purified
More Information
SKU AVIARP53814_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53814_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2712
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×