GLDC Antibody - C-terminal region : Biotin

GLDC Antibody - C-terminal region : Biotin
SKU
AVIARP54298_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GCSP

Key Reference: N/A

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: ANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: glycine dehydrogenase (decarboxylating), mitochondrial

Protein Size: 1020

Purification: Affinity purified
More Information
SKU AVIARP54298_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54298_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2731
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×