GLP-1 (9-36) amide (trifluoroacetate salt)

GLP-1 (9-36) amide (trifluoroacetate salt)
SKU
CAY36863-10
Packaging Unit
10 mg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-a-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-a-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-a-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-argininamide, trifluoroacetate salt

Amino Acids: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Purity: ≥95%

Formula Markup: C140H214N36O43 / XCF3COOH

Formula Weight: 3089.414

Notes: A peptide agonist of GLP-1R and an active metabolite of GLP-1 (7-36) amide; induces cAMP production in a reporter assay using HEK293 cells expressing human GLP-1R (EC50 = 309.03 µM); reduces blood glucose levels in pigs when infused at 2.55 pmol/kg per minute; decreases left ventricle systolic pressure and end-diastolic pressure and heart contractility and rate in a dog model of dilated cardiomyopathy when infused at 1.5 pmol/kg per minute; increases mean arterial blood pressure, stroke volume, myocardial glucose uptake, and plasma norepinephrine levels in the same model
More Information
SKU CAY36863-10
Manufacturer Cayman Chemical
Manufacturer SKU 36863-10
Package Unit 10 mg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×