GNAL Antibody - C-terminal region : Biotin

GNAL Antibody - C-terminal region : Biotin
SKU
AVIARP54634_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNAL

Key Reference: Laurin,N., (2008) J Psychiatr Res 42 (2), 117-124

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(olf) subunit alpha

Protein Size: 458

Purification: Affinity Purified

Subunit: alpha
More Information
SKU AVIARP54634_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54634_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2774
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×