GNAQ Antibody - N-terminal region : HRP

GNAQ Antibody - N-terminal region : HRP
SKU
AVIARP54635_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G p

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAQ

Key Reference: Zapf,J., (2008) Am. J. Hum. Genet. 82 (6), 1270-1280

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha
More Information
SKU AVIARP54635_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54635_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2776
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×