GOLGA7 Antibody - N-terminal region : Biotin

GOLGA7 Antibody - N-terminal region : Biotin
SKU
AVIARP56836_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGA7

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgin subfamily A member 7

Protein Size: 137

Purification: Affinity Purified
More Information
SKU AVIARP56836_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56836_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51125
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×