GORASP1 Antibody - N-terminal region : FITC

GORASP1 Antibody - N-terminal region : FITC
SKU
AVIARP57679_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GORASP1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi reassembly-stacking protein 1

Protein Size: 440

Purification: Affinity Purified
More Information
SKU AVIARP57679_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57679_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64689
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×