Gpatc2 Antibody - C-terminal region : HRP

Gpatc2 Antibody - C-terminal region : HRP
SKU
AVIARP57094_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gpatc2

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: DELRSESDSSSLSSTDAGLFTNDEGRQVFILIVRNFKVRSPSKGKLMSGN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: G patch domain containing 2 EMBL AAH79232.1

Protein Size: 410

Purification: Affinity Purified
More Information
SKU AVIARP57094_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57094_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 289362
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×