GPD1L Antibody - middle region : FITC

GPD1L Antibody - middle region : FITC
SKU
AVIARP55177_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPD1L

Key Reference: London,B., (2007) Circulation 116 (20), 2260-2268

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycerol-3-phosphate dehydrogenase 1-like protein

Protein Size: 351

Purification: Affinity Purified
More Information
SKU AVIARP55177_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55177_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23171
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×