GPD1L Antibody - middle region : HRP

GPD1L Antibody - middle region : HRP
SKU
AVIARP55177_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPD1L

Key Reference: London,B., (2007) Circulation 116 (20), 2260-2268

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glycerol-3-phosphate dehydrogenase 1-like protein

Protein Size: 351

Purification: Affinity Purified
More Information
SKU AVIARP55177_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55177_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23171
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×