GPRC6A Antibody - N-terminal region (ARP64455_P050)

Description of Target: Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRC6A

Molecular Weight: 103kDa

Peptide Sequence: Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: G-protein coupled receptor family C group 6 member A

Protein Size: 926

Purification: Affinity Purified

• SKU: AVIARP64455-P050
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP64455_P050
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 222545
• Host: Rabbit
• Conjugate: Unconjugated