GSR Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSR

Key Reference: Senturk,M., (2008) J Enzyme Inhib Med Chem 23 (1), 144-148

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutathione reductase, mitochondrial

Protein Size: 522

Purification: Affinity Purified

• SKU: AVIARP54344_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54344_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2936
• Host: Rabbit
• Conjugate: Conjugated, Biotin