GSS Antibody - C-terminal region : HRP

GSS Antibody - C-terminal region : HRP
SKU
AVIARP54302_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSHB

Key Reference: N/A

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: FRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: glutathione synthetase

Protein Size: 474

Purification: Affinity purified
More Information
SKU AVIARP54302_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54302_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2937
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×