GSS Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSHB

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: QIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: glutathione synthetase

Protein Size: 474

Purification: Affinity purified

• SKU: AVIARP54301_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54301_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2937
• Host: Rabbit
• Conjugate: Conjugated, HRP