GSTK1 Antibody - middle region : FITC

GSTK1 Antibody - middle region : FITC
SKU
AVIARP55335_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GSTK1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutathione S-transferase kappa 1

Protein Size: 226

Purification: Affinity Purified
More Information
SKU AVIARP55335_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55335_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 373156
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×