GTF2A1 Antibody - middle region : Biotin

GTF2A1 Antibody - middle region : Biotin
SKU
AVIARP58156_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Transcription initiation factor IIA . and . chains (GTF2A1, TFIIA p35 and p19 subunits, TFIIAL) binding ability of TLP is required for characteristic cytoplasmic localization of TLP. TFIIA may regulate the intracellular molecular state and the function of TLP through its property of binding to TLP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GTF2A1

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor IIA subunit 1

Protein Size: 337

Purification: Affinity Purified

Subunit: 1
More Information
SKU AVIARP58156_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58156_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2957
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×