GTF2B Antibody - N-terminal region

Description of Target: GTF2B is the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2B

Key Reference: Tubon,T.C., et al., (2004) Mol. Cell. Biol. 24 (7), 2863-2874

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Transcription initiation factor IIB

Protein Size: 316

Purification: Protein A purified

• SKU: AVIP100990_T100-25
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: P100990_T100-25UL
• Package Unit: 25µl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2959
• Host: Rabbit
• Conjugate: Unconjugated