Guk1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Guk1 Ensembl ENSRNOP00000003926

Protein Size: 219

Purification: Affinity Purified

• SKU: AVIARP54357_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54357_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 303179
• Host: Rabbit
• Conjugate: Conjugated, Biotin