HAGH Antibody - C-terminal region : Biotin

HAGH Antibody - C-terminal region : Biotin
SKU
AVIARP54515_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HAGH belongs to the metallo-beta-lactamase superfamily, glyoxalase II family. It is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAGH

Key Reference: Xu,Y. (2006) J. Biol. Chem. 281 (36), 26702-26713

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxyacylglutathione hydrolase, mitochondrial

Protein Size: 260

Purification: Affinity Purified
More Information
SKU AVIARP54515_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54515_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3029
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×