Uniprot: Q99075
Gene Name: HBEGF
Immunogen: Recombinant human HBEGF
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 73%
Core Sequence: LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 76%, Pig - 93%, Cynomolgus monkey - 99%
Alternative gene names: DTR；DTS；HEGFL
Alternative protein names: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor; HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R]
Protein name: Heparin binding EGF like growth factor
Clone No.: K16295_18H8
Antigen Species: Human
Target Name: HBEGF
IHC Verification: Fail (Heart Muscle)
IHC Dilution: N/A
WB Verification: -
WB Dilution: N/A
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: succeed
Sandwich ELISA Dilution: 1:250~1:500
Antigen ID: PP-3105
Cross reactivity: Not tested
English
Deutsch
