HCFC1R1 Antibody - middle region : HRP

HCFC1R1 Antibody - middle region : HRP
SKU
AVIARP56149_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HCFC1R1

Key Reference: Mahajan,S.S., (2002) J. Biol. Chem. 277 (46), 44292-44299

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Host cell factor C1 regulator 1

Protein Size: 138

Purification: Affinity Purified
More Information
SKU AVIARP56149_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56149_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54985
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×