Hddc3 Antibody - middle region : HRP

Hddc3 Antibody - middle region : HRP
SKU
AVIARP55897_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Hddc3

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: EVELHFGAQVRRLVEEVTDDKTLPKLERKRQQVEQAPHSSPGAKLVKLAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: HD domain containing 3 (Predicted), isoform CRA_b EMBL EDM08633.1

Protein Size: 179

Purification: Affinity Purified
More Information
SKU AVIARP55897_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55897_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 308758
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×