HIKESHI Antibody - N-terminal region : Biotin

HIKESHI Antibody - N-terminal region : Biotin
SKU
AVIARP56902_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat l7Rn6

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein Hikeshi

Protein Size: 158

Purification: Affinity Purified
More Information
SKU AVIARP56902_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56902_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 293103
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×