Histone H1, Full Length, His-tag Recombinant

Histone H1, Full Length, His-tag Recombinant
SKU
BPS52043-2
Packaging Unit
1 mg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 2-194(end)

Amino Acid Sequence: MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Application: Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.

Background: Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation.

Description: Human Histone H1, also known as H1F0, (GenBank Accession No. NM_005318), a.a. 2-194(end) with N-terminal His-tag, MW = 21.7 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol

Genbank: NM_005318

Storage Stability: At least 6 months at -80°C.

Supplied As: Histone H1, H1F0

Uniprot: P07305

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Doenecke, D., et al., J. Mol.Biol. 1986
Feb 5;187(3):461-4.
2. Vyas, P., et al., J. Biol. Chem. 2012 Apr
6;287(15):11778-87.
More Information
SKU BPS52043-2
Manufacturer BPS Bioscience
Manufacturer SKU 52043-2
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF)
×