Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 2-136(end)
Amino Acid Sequence: MACHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Application: Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Description: Biotinylated Human Histone 3, GenBank Accession No. NM_003532, a.a. 2-136(end) with N-terminal Met-Ala-Cys-6xHis-tag (C97A,C111A). MW = 16.3 kDa, expressed in an E. coli expression system.
Format: Aqueous buffer solution
Formulation: 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol
Genbank: NM_003532
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal His-tag, Biotin
Uniprot: P68431
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Loyola, A. et al., Mol. Cell 24 (2), 309-
316 (2006).
2. Hans, F. and Dimitrov, S. Oncogene
20(24), 3021-3027 (2001).