HMCES Antibody - N-terminal region : Biotin

HMCES Antibody - N-terminal region : Biotin
SKU
AVIARP57365_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HMCES specifically binds 5-hydroxymethylcytosine (5hmC)- containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells (By similarity). IT may act as a peptidase; experimental evidences are however required to confirm this prediction.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMCES

Key Reference: N/A

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0361 protein C3orf37

Protein Size: 354

Purification: Affinity purified
More Information
SKU AVIARP57365_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57365_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56941
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×