HMCES Antibody - N-terminal region : HRP

HMCES Antibody - N-terminal region : HRP
SKU
AVIARP57365_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HMCES specifically binds 5-hydroxymethylcytosine (5hmC)- containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells (By similarity). IT may act as a peptidase; experimental evidences are however required to confirm this prediction.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMCES

Key Reference: N/A

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UPF0361 protein C3orf37

Protein Size: 354

Purification: Affinity purified
More Information
SKU AVIARP57365_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57365_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56941
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×