HMGB2 Antibody - middle region : HRP

HMGB2 Antibody - middle region : HRP
SKU
AVIARP58158_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HMGB2 is a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HMGB2

Key Reference: 0

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: High mobility group protein B2

Protein Size: 209

Purification: Affinity Purified
More Information
SKU AVIARP58158_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58158_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3148
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×