HOOK2 Antibody - middle region : HRP

HOOK2 Antibody - middle region : HRP
SKU
AVIARP54934_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HOOK2

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRAGSLRAQLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Hook homolog 2

Protein Size: 719

Purification: Affinity purified
More Information
SKU AVIARP54934_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54934_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29911
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×