HSPA4L Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA4L

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Heat shock 70 kDa protein 4L

Protein Size: 839

Purification: Affinity Purified

• SKU: AVIARP53693_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53693_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22824
• Host: Rabbit
• Conjugate: Conjugated, HRP