HSPA6 Antibody - middle region : FITC

HSPA6 Antibody - middle region : FITC
SKU
AVIARP54649_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPA6

Key Reference: Noonan,E.J., (2007) Cell Stress Chaperones 12 (4), 393-402

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock 70 kDa protein 6

Protein Size: 643

Purification: Affinity Purified
More Information
SKU AVIARP54649_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54649_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3310
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×