IARS Antibody - middle region : Biotin

IARS Antibody - middle region : Biotin
SKU
AVIARP54954_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IARS

Molecular Weight: 144kDa

Peptide Sequence: Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isoleucine--tRNA ligase, cytoplasmic

Protein Size: 1262

Purification: Affinity Purified
More Information
SKU AVIARP54954_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54954_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3376
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×