IARS Antibody - N-terminal region : FITC

IARS Antibody - N-terminal region : FITC
SKU
AVIARP54953_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IARS

Molecular Weight: 144kDa

Peptide Sequence: Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isoleucine--tRNA ligase, cytoplasmic

Protein Size: 1262

Purification: Affinity Purified
More Information
SKU AVIARP54953_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54953_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3376
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×