IFNA7 Antibody - N-terminal region : FITC

IFNA7 Antibody - N-terminal region : FITC
SKU
AVIARP55373_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFNA7

Key Reference: Nyman,T.A., Biochem. J. 329 (PT 2), 295-302 (1998)

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon alpha-7

Protein Size: 189

Purification: Affinity Purified
More Information
SKU AVIARP55373_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55373_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3444
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×